PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000762302
Common NameLOC103409624, NAC6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 401aa    MW: 46018.1 Da    PI: 6.2337
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000762302genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.76.9e-51161441128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                    +ppGfrFhPt+eel+++yL+kkv+ ++++l +vi+evd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++
  MDP0000762302  16 VPPGFRFHPTEEELLHYYLRKKVAFERIDL-DVIREVDLNKLEPWDIQEKCKIgstPQNDWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKIIY 110
                    69****************************.9***************964444222455************************************* PP

            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                    s + + +gl+ktLvfykgrap+g+k+dW+mheyrl
  MDP0000762302 111 S-GFKRIGLRKTLVFYKGRAPHGQKSDWIMHEYRL 144
                    *.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-5710175IPR003441NAC domain
PROSITE profilePS5100556.23616175IPR003441NAC domain
PfamPF023651.6E-2617144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MSDDQMSLSI NGQSQVPPGF RFHPTEEELL HYYLRKKVAF ERIDLDVIRE VDLNKLEPWD  60
IQEKCKIGST PQNDWYFFSH KDKKYPTGTR TNRATTAGFW KATGRDKIIY SGFKRIGLRK  120
TLVFYKGRAP HGQKSDWIMH EYRLDESNTH ETTVSSSMGE SMTEEGWVVC RVFKKKNYQK  180
ALESPKASFS MDSSNNQMHG SRNDGVLDQI LMYMGRTTCK LENHDQSLTM NNISERFMHL  240
PRLESPTLPN LPTFDQERSF KACYSAIDDM FIETEPSSTN QPSNGCHNND LVDDHEYPKT  300
RLNDWATLDR LVASQLGQLN GQDQETPKHL SCFGDPNMAF CSSPHPNDQD NDVQLSYPYL  360
RTSRSSDHQS EVYNNENDLW NFTKSSSSPS SSDPLCHLSV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-491217711170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.168600.0bud| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008346654.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-117NAC43_ARATH; NAC domain-containing protein 43
TrEMBLD9ZJA50.0D9ZJA5_MALDO; NAC domain class transcription factor
STRINGPOPTR_0011s15640.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-101NAC family protein